| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Programmed cell death 1 ligand 1 |
|---|
| Ligand | BDBM50239943 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1791472 (CHEMBL4263391) |
|---|
| IC50 | 146±n/a nM |
|---|
| Citation |  Acúrcio, RC; Scomparin, A; Conniot, J; Salvador, JAR; Satchi-Fainaro, R; Florindo, HF; Guedes, RC Structure-Function Analysis of Immune Checkpoint Receptors to Guide Emerging Anticancer Immunotherapy. J Med Chem61:10957-10975 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Programmed cell death 1 ligand 1 |
|---|
| Name: | Programmed cell death 1 ligand 1 |
|---|
| Synonyms: | B7 homolog 1 | B7-H1 | B7H1 | B7H1 | CD274 | CD_antigen=CD274 | PD-L1 | PD1L1_HUMAN | PDCD1 ligand 1 | PDCD1L1 | PDCD1LG1 | PDL1 | Programmed cell death 1 ligand 1 | Programmed death ligand 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 33278.49 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_109807 |
|---|
| Residue: | 290 |
|---|
| Sequence: | MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET
|
|
|
|---|
| BDBM50239943 |
|---|
| n/a |
|---|
| Name | BDBM50239943 |
|---|
| Synonyms: | CHEMBL4099869 | US9872852, Example 8 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H28BrNO3 |
|---|
| Mol. Mass. | 494.42 |
|---|
| SMILES | Cc1c(COc2ccc(CN3CCCCC3C(O)=O)cc2Br)cccc1-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
