Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50466981 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1794680 (CHEMBL4266797) |
---|
Ki | 228±n/a nM |
---|
Citation | Zampieri, D; Romano, M; Menegazzi, R; Mamolo, MG New piperidine-based derivatives as sigma receptor ligands. Synthesis and pharmacological evaluation. Bioorg Med Chem Lett28:3206-3209 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50466981 |
---|
n/a |
---|
Name | BDBM50466981 |
Synonyms: | CHEMBL4283915 |
Type | Small organic molecule |
Emp. Form. | C17H25ClN2O |
Mol. Mass. | 308.846 |
SMILES | CCN(CC1CCN(Cc2ccc(Cl)cc2)CC1)C(C)=O |
Structure |
|