Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM50466984 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1794681 (CHEMBL4266798) |
---|
Ki | 1377±n/a nM |
---|
Citation | Zampieri, D; Romano, M; Menegazzi, R; Mamolo, MG New piperidine-based derivatives as sigma receptor ligands. Synthesis and pharmacological evaluation. Bioorg Med Chem Lett28:3206-3209 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20953.88 |
Organism: | Rattus norvegicus (Rat) |
Description: | Q5U3Y7 |
Residue: | 176 |
Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
BDBM50466984 |
---|
n/a |
---|
Name | BDBM50466984 |
Synonyms: | CHEMBL4284597 |
Type | Small organic molecule |
Emp. Form. | C19H29ClN2O |
Mol. Mass. | 336.899 |
SMILES | CCCCN(CC1CCN(Cc2ccc(Cl)cc2)CC1)C(C)=O |
Structure |
|