Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Aldo-keto reductase family 1 member B1 |
---|
Ligand | BDBM16415 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_31780 (CHEMBL643106) |
---|
IC50 | 140000±n/a nM |
---|
Citation | Kador, PF; Kinoshita, JH; Sharpless, NE Aldose reductase inhibitors: a potential new class of agents for the pharmacological control of certain diabetic complications. J Med Chem28:841-9 (1985) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Aldo-keto reductase family 1 member B1 |
---|
Name: | Aldo-keto reductase family 1 member B1 |
Synonyms: | AKR1B1 | ALDR1 | ALDR_HUMAN | ALR2 | AR | Aldo-keto reductase family 1 member B1 (AKR1B1) | Aldose Reductase (ALR2) | Aldose reductase | Aldose reductase (AR) |
Type: | Protein |
Mol. Mass.: | 35855.50 |
Organism: | Homo sapiens (Human) |
Description: | P15121. 4LAU; 2IKI; 4LB4; 2FZD; 2FZ8; 1US0 |
Residue: | 316 |
Sequence: | MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
|
|
|
BDBM16415 |
---|
n/a |
---|
Name | BDBM16415 |
Synonyms: | (1,3-dioxo-1H-benzo[de]isoquinolin-2(3H)-yl)acetic acid | 2-{2,4-dioxo-3-azatricyclo[7.3.1.0^{5,13}]trideca-1(12),5,7,9(13),10-pentaen-3-yl}acetic acid | Alrestatin | CHEMBL63055 | PiG | Spectrum_001449 | Tocris-0485 |
Type | Small organic molecule |
Emp. Form. | C14H9NO4 |
Mol. Mass. | 255.2256 |
SMILES | OC(=O)CN1C(=O)c2cccc3cccc(C1=O)c23 |
Structure |
|