Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Fatty acid-binding protein, heart |
---|
Ligand | BDBM50468377 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1799372 (CHEMBL4271664) |
---|
IC50 | >100000±n/a nM |
---|
Citation | Gao, DD; Dou, HX; Su, HX; Zhang, MM; Wang, T; Liu, QF; Cai, HY; Ding, HP; Yang, Z; Zhu, WL; Xu, YC; Wang, HY; Li, YX From hit to lead: Structure-based discovery of naphthalene-1-sulfonamide derivatives as potent and selective inhibitors of fatty acid binding protein 4. Eur J Med Chem154:44-59 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein, heart |
---|
Name: | Fatty acid-binding protein, heart |
Synonyms: | FABP11 | FABP3 | FABPH_HUMAN | Fatty acid binding protein muscle | MDGI |
Type: | PROTEIN |
Mol. Mass.: | 14858.36 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1463784 |
Residue: | 133 |
Sequence: | MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA
|
|
|
BDBM50468377 |
---|
n/a |
---|
Name | BDBM50468377 |
Synonyms: | CHEMBL4280127 |
Type | Small organic molecule |
Emp. Form. | C18H13F2NO5S |
Mol. Mass. | 393.361 |
SMILES | COc1ccc(c2ccccc12)S(=O)(=O)Nc1cc(C(O)=O)c(F)cc1F |
Structure |
|