Reaction Details |
| Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM50468682 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1800963 (CHEMBL4273255) |
---|
Ki | 301±n/a nM |
---|
Citation | Estrada Valencia, M; Herrera-Arozamena, C; de Andrés, L; Pérez, C; Morales-García, JA; Pérez-Castillo, A; Ramos, E; Romero, A; Viña, D; Yáñez, M; Laurini, E; Pricl, S; Rodríguez-Franco, MI Neurogenic and neuroprotective donepezil-flavonoid hybrids with sigma-1 affinity and inhibition of key enzymes in Alzheimer's disease. Eur J Med Chem156:534-553 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20953.88 |
Organism: | Rattus norvegicus (Rat) |
Description: | Q5U3Y7 |
Residue: | 176 |
Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
BDBM50468682 |
---|
n/a |
---|
Name | BDBM50468682 |
Synonyms: | CHEMBL4284165 |
Type | Small organic molecule |
Emp. Form. | C25H28N2O4 |
Mol. Mass. | 420.5008 |
SMILES | Oc1ccc2oc(cc(=O)c2c1)C(=O)NCCCC1CCN(Cc2ccccc2)CC1 |
Structure |
|