| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50422052 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_158028 (CHEMBL858358) |
|---|
| Kd | 0.707946±n/a nM |
|---|
| Citation |  Ishchenko, AV; Shakhnovich, EI SMall Molecule Growth 2001 (SMoG2001): an improved knowledge-based scoring function for protein-ligand interactions. J Med Chem45:2770-80 (2002) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50422052 |
|---|
| n/a |
|---|
| Name | BDBM50422052 |
|---|
| Synonyms: | CHEMBL109952 | L-700417 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C39H42N2O5 |
|---|
| Mol. Mass. | 618.7612 |
|---|
| SMILES | OC(C[C@@H](Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12)C[C@@H](Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
