Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Substance-K receptor |
---|
Ligand | BDBM50476250 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_430641 (CHEMBL918150) |
---|
Ki | 0.100000±n/a nM |
---|
Citation | Fedi, V; Altamura, M; Balacco, G; Canfarini, F; Criscuoli, M; Giannotti, D; Giolitti, A; Giuliani, S; Guidi, A; Harmat, NJ; Nannicini, R; Pasqui, F; Patacchini, R; Perrotta, E; Tramontana, M; Triolo, A; Maggi, CA Insertion of an aspartic acid moiety into cyclic pseudopeptides: synthesis and biological characterization of potent antagonists for the human Tachykinin NK-2 receptor. J Med Chem47:6935-47 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Substance-K receptor |
---|
Name: | Substance-K receptor |
Synonyms: | NK-2 receptor | NK-2R | NK2R | NK2R_HUMAN | NKNAR | Neurokinin 2 receptor | Neurokinin A receptor | Neurokinin NK2 | Neurokinin-2 (NK-2) | Neuromedin-2 receptor (NK-2R) | SKR | TAC2R | TACR2 | Tachykinin receptor 2 | Tachykinin receptor 2 (NK2) | hnk-3 |
Type: | Protein |
Mol. Mass.: | 44455.78 |
Organism: | Homo sapiens (Human) |
Description: | P21452 |
Residue: | 398 |
Sequence: | MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA
HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATK
CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR
HLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMA
GDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI
|
|
|
BDBM50476250 |
---|
n/a |
---|
Name | BDBM50476250 |
Synonyms: | CHEMBL389510 |
Type | Small organic molecule |
Emp. Form. | C38H44N6O4S |
Mol. Mass. | 680.859 |
SMILES | O=C1C[C@@H](NC2CCSCC2)C(=O)NC[C@@H](Cc2ccccc2)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](Cc2c[nH]c3ccccc23)N1 |r| |
Structure |
|