Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | HIV-1 protease |
---|
Ligand | BDBM50476647 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_445721 (CHEMBL896012) |
---|
Ki | 4.6±n/a nM |
---|
Citation | Wang, YF; Tie, Y; Boross, PI; Tozser, J; Ghosh, AK; Harrison, RW; Weber, IT Potent new antiviral compound shows similar inhibition and structural interactions with drug resistant mutants and wild type HIV-1 protease. J Med Chem50:4509-15 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
HIV-1 protease |
---|
Name: | HIV-1 protease |
Synonyms: | HIV-1 | HIV-1 protease | protease |
Type: | PROTEIN |
Mol. Mass.: | 10795.19 |
Organism: | Human immunodeficiency virus |
Description: | ChEMBL_118439 |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50476647 |
---|
n/a |
---|
Name | BDBM50476647 |
Synonyms: | CHEMBL178593 | GRL-98065 |
Type | Small organic molecule |
Emp. Form. | C28H36N2O9S |
Mol. Mass. | 576.658 |
SMILES | [H][C@@]12CCO[C@]1([H])OC[C@@H]2OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc2OCOc2c1 |r| |
Structure |
|