| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50478129 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_469364 (CHEMBL933047) |
|---|
| Ki | 2.4±n/a nM |
|---|
| Citation |  Wu, X; Ohrngren, P; Ekegren, JK; Unge, J; Unge, T; Wallberg, H; Samuelsson, B; Hallberg, A; Larhed, M Two-carbon-elongated HIV-1 protease inhibitors with a tertiary-alcohol-containing transition-state mimic. J Med Chem51:1053-7 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50478129 |
|---|
| n/a |
|---|
| Name | BDBM50478129 |
|---|
| Synonyms: | CHEMBL270059 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H41BrN4O6 |
|---|
| Mol. Mass. | 681.617 |
|---|
| SMILES | COC(=O)N[C@H](C(=O)NN(Cc1ccc(Br)cc1)C[C@](O)(Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12)C(C)(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
