| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50479300 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_491541 (CHEMBL937811) |
|---|
| IC50 | 75400±n/a nM |
|---|
| Citation |  El Dine, RS; El Halawany, AM; Ma, CM; Hattori, M Anti-HIV-1 protease activity of lanostane triterpenes from the vietnamese mushroom Ganoderma colossum. J Nat Prod71:1022-6 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50479300 |
|---|
| n/a |
|---|
| Name | BDBM50479300 |
|---|
| Synonyms: | COLOSSOLACTONE A |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H52O5 |
|---|
| Mol. Mass. | 516.7523 |
|---|
| SMILES | [H][C@@]1(CC[C@@]2(C)C3=C(CC[C@]12C)[C@@]1(COC(C)=O)CC[C@H](O)C(C)(C)[C@]1([H])CC3)[C@H](C)C(O)C\C=C(\C)CO |r,c:6| |
|---|
| Structure | 
|
|---|
Search and Browse
