| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM50479322 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_535569 (CHEMBL987043) |
|---|
| IC50 | 24±n/a nM |
|---|
| Citation |  Melamed, JY; Egbertson, MS; Varga, S; Vacca, JP; Moyer, G; Gabryelski, L; Felock, PJ; Stillmock, KA; Witmer, MV; Schleif, W; Hazuda, DJ; Leonard, Y; Jin, L; Ellis, JD; Young, SD Synthesis of 5-(1-H or 1-alkyl-5-oxopyrrolidin-3-yl)-8-hydroxy-[1,6]-naphthyridine-7-carboxamide inhibitors of HIV-1 integrase. Bioorg Med Chem Lett18:5307-10 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | pol |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32203.43 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_106649 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM50479322 |
|---|
| n/a |
|---|
| Name | BDBM50479322 |
|---|
| Synonyms: | CHEMBL514836 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H17FN4O3 |
|---|
| Mol. Mass. | 380.3724 |
|---|
| SMILES | Oc1c(nc(C2CNC(=O)C2)c2cccnc12)C(=O)NCc1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
