| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50422052 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_537468 (CHEMBL990633) |
|---|
| IC50 | 0.600000±n/a nM |
|---|
| Citation |  Raza, A; Sham, YY; Vince, R Design and synthesis of sulfoximine based inhibitors for HIV-1 protease. Bioorg Med Chem Lett18:5406-10 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50422052 |
|---|
| n/a |
|---|
| Name | BDBM50422052 |
|---|
| Synonyms: | CHEMBL109952 | L-700417 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C39H42N2O5 |
|---|
| Mol. Mass. | 618.7612 |
|---|
| SMILES | OC(C[C@@H](Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12)C[C@@H](Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
