| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM50479415 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_559818 (CHEMBL1020689) |
|---|
| IC50 | 100±n/a nM |
|---|
| Citation |  Ferro, S; De Luca, L; Barreca, ML; Iraci, N; De Grazia, S; Christ, F; Witvrouw, M; Debyser, Z; Chimirri, A Docking studies on a new human immunodeficiency virus integrase-Mg-DNA complex: phenyl ring exploration and synthesis of 1H-benzylindole derivatives through fluorine substitutions. J Med Chem52:569-73 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | pol |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32203.43 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_106649 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM50479415 |
|---|
| n/a |
|---|
| Name | BDBM50479415 |
|---|
| Synonyms: | CHEMBL498202 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H14F3NO5 |
|---|
| Mol. Mass. | 405.3241 |
|---|
| SMILES | COc1cccc2n(Cc3cc(F)c(F)c(F)c3)cc(C(=O)\C=C(/O)C(O)=O)c12 |
|---|
| Structure | 
|
|---|
Search and Browse
