Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Integrase |
---|
Ligand | BDBM50029207 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_519245 (CHEMBL946684) |
---|
IC50 | >100000±n/a nM |
---|
Citation | Xia, CN; Li, HB; Liu, F; Hu, WX Synthesis of trans-caffeate analogues and their bioactivities against HIV-1 integrase and cancer cell lines. Bioorg Med Chem Lett18:6553-7 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Integrase |
---|
Name: | Integrase |
Synonyms: | pol |
Type: | PROTEIN |
Mol. Mass.: | 32203.43 |
Organism: | Human immunodeficiency virus 1 |
Description: | ChEMBL_106649 |
Residue: | 288 |
Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
BDBM50029207 |
---|
n/a |
---|
Name | BDBM50029207 |
Synonyms: | (E)-3-(3,4-Dihydroxy-phenyl)-acrylic acid phenethyl ester | (E)-phenethyl 3-(3,4-dihydroxyphenyl)acrylate | 3-(3,4-Dihydroxy-phenyl)-acrylic acid phenethyl ester | CAPE | CHEMBL319244 | caffeic acid phenethyl ester | caffeic acid phenethylester | caffeic acid phenylethyl ester | caffeic acid phenylethylester | caffeic acidphenethylester | phenethyl 3-(3,4-dihydroxyphenyl)acrylate | phenethyl caffeate |
Type | Small organic molecule |
Emp. Form. | C17H16O4 |
Mol. Mass. | 284.3065 |
SMILES | Oc1ccc(\C=C\C(=O)OCCc2ccccc2)cc1O |
Structure |
|