| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HIV-1 protease |
|---|
| Ligand | BDBM81677 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_517306 (CHEMBL1031359) |
|---|
| Ki | 1175±n/a nM |
|---|
| Citation |  Jorissen, RN; Reddy, GS; Ali, A; Altman, MD; Chellappan, S; Anjum, SG; Tidor, B; Schiffer, CA; Rana, TM; Gilson, MK Additivity in the analysis and design of HIV protease inhibitors. J Med Chem52:737-54 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HIV-1 protease |
|---|
| Name: | HIV-1 protease |
|---|
| Synonyms: | HIV-1 | HIV-1 protease | protease |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 10795.19 |
|---|
| Organism: | Human immunodeficiency virus |
|---|
| Description: | ChEMBL_118439 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM81677 |
|---|
| n/a |
|---|
| Name | BDBM81677 |
|---|
| Synonyms: | CARB-KB32 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H35N3O7S |
|---|
| Mol. Mass. | 521.626 |
|---|
| SMILES | CNC(=O)CCC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(C[C@@H](C)O)S(=O)(=O)c1cccc(OC)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
