| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Matrix protein 2 |
|---|
| Ligand | BDBM50216627 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_639626 (CHEMBL1175304) |
|---|
| Kd | 16±n/a nM |
|---|
| Citation |  Eleftheratos, S; Spearpoint, P; Ortore, G; Kolocouris, A; Martinelli, A; Martin, S; Hay, A Interaction of aminoadamantane derivatives with the influenza A virus M2 channel-docking using a pore blocking model. Bioorg Med Chem Lett20:4182-7 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Matrix protein 2 |
|---|
| Name: | Matrix protein 2 |
|---|
| Synonyms: | M | M2_I000F | Matrix protein 2 | Proton channel protein M2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 11173.62 |
|---|
| Organism: | Influenza A virus |
|---|
| Description: | ChEMBL_117202 |
|---|
| Residue: | 97 |
|---|
| Sequence: | MSLLTEVETPTRNGWECSCSDSSDPLVIAASIIGILHFILWILDRLFFKCIYRRLKYGLK
RGPSTEGVPKSMREEYRQEQQNAVDVDDGHFVNIELE
|
|
|
|---|
| BDBM50216627 |
|---|
| n/a |
|---|
| Name | BDBM50216627 |
|---|
| Synonyms: | (alpha-methyl-1-adamantyl)methylamine | 1-Adamantan-1-yl-ethylamine | CHEMBL959 | RIMANTADINE | US11241393, Rimantadine | rimantadin | rimantidin |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H21N |
|---|
| Mol. Mass. | 179.3018 |
|---|
| SMILES | CC(N)C12CC3CC(CC(C3)C1)C2 |TLB:10:5:12:9.8.11,10:9:12:6.5.4,THB:4:5:8:12.3.11,4:3:6.5.10:8,1:3:6.5.10:8| |
|---|
| Structure | 
|
|---|
Search and Browse
