| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Killer cell lectin-like receptor subfamily B member 1A |
|---|
| Ligand | BDBM50482395 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_643486 (CHEMBL1212350) |
|---|
| IC50 | 316±n/a nM |
|---|
| Citation |  Catelani, G; D'Andrea, F; Griselli, A; Guazzelli, L; Nemcová, P; Bezouska, K; Krenek, K; Kren, V Deoxynojirimycin and its hexosaminyl derivatives bind to natural killer cell receptors rNKR-P1A and hCD69. Bioorg Med Chem Lett20:4645-8 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Killer cell lectin-like receptor subfamily B member 1A |
|---|
| Name: | Killer cell lectin-like receptor subfamily B member 1A |
|---|
| Synonyms: | Antigen 3.2.3 | CD161 antigen-like family member A | CD_antigen=CD161a | KLRBA_RAT | Killer cell lectin-like receptor subfamily B member 1A | Klrb1a | NKR-P1 3.2.3 | NKR-P1A | Natural killer cell surface protein P1-3.2.3 | Nkrp1a |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 24555.68 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_109233 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MDTARVYLSLKPSKTAAGAQCVSPPSLPPDACRCPRSHRLALKLSCAGLILLVLALVGMS
ILVRVLVQKPSVEPCRVLIQENLSKTGSPAKLKCPKDWLSHRDKCFHVSQTSITWKESLA
DCGGKGATLLLVQDQEELRFLRNLTKRISSSFWIGLSYTLSDENWKWINGSTLNSDVLSI
TGDTEKDSCASVSQDKVLSESCDSDNIWVCQKELKCECMCNDS
|
|
|
|---|
| BDBM50482395 |
|---|
| n/a |
|---|
| Name | BDBM50482395 |
|---|
| Synonyms: | CHEMBL1210904 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H27ClN2O9 |
|---|
| Mol. Mass. | 402.825 |
|---|
| SMILES | Cl.[H][C@@]1(O[C@@H]2O[C@H](CO)[C@@H](O)[C@H](O)[C@@H]2NC(C)=O)[C@@H](CO)NC[C@H](O)[C@H]1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
