| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase protein |
|---|
| Ligand | BDBM50483018 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_677443 (CHEMBL1279436) |
|---|
| Kd | 43400±n/a nM |
|---|
| Citation |  Yang, G; Wang, J; Cheng, Y; Dutschman, GE; Tanaka, H; Baba, M; Cheng, YC Mechanism of inhibition of human immunodeficiency virus type 1 reverse transcriptase by a stavudine analogue, 4'-ethynyl stavudine triphosphate. Antimicrob Agents Chemother52:2035-42 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase protein |
|---|
| Name: | Reverse transcriptase protein |
|---|
| Synonyms: | Reverse Transcriptase | Reverse Transcriptase (A62V) | Reverse Transcriptase (F61A) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 30203.56 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WJQ2 |
|---|
| Residue: | 259 |
|---|
| Sequence: | PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYEHHPDKWT
VQPIVLPEKDSWTVNDIQK
|
|
|
|---|
| BDBM50483018 |
|---|
| n/a |
|---|
| Name | BDBM50483018 |
|---|
| Synonyms: | CHEMBL485651 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H15N2O13P3 |
|---|
| Mol. Mass. | 488.1744 |
|---|
| SMILES | Cc1cn([C@@H]2O[C@](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)(C=C2)C#C)c(=O)[nH]c1=O |r,c:21| |
|---|
| Structure | 
|
|---|
Search and Browse
