Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Reverse transcriptase |
---|
Ligand | BDBM50164648 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_677578 (CHEMBL1278416) |
---|
Kd | 15400±n/a nM |
---|
Citation | Yang, G; Wang, J; Cheng, Y; Dutschman, GE; Tanaka, H; Baba, M; Cheng, YC Mechanism of inhibition of human immunodeficiency virus type 1 reverse transcriptase by a stavudine analogue, 4'-ethynyl stavudine triphosphate. Antimicrob Agents Chemother52:2035-42 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Reverse transcriptase |
---|
Name: | Reverse transcriptase |
Synonyms: | n/a |
Type: | Protein |
Mol. Mass.: | 29598.37 |
Organism: | Human immunodeficiency virus 1 |
Description: | Q9WKE8 |
Residue: | 254 |
Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
BDBM50164648 |
---|
n/a |
---|
Name | BDBM50164648 |
Synonyms: | 2'-deoxythymidine triphosphate | 5'-TTP | CHEMBL363559 | dTTP | dThd5'PPP | deoxy-TTP | pppdT | thymidine 5'-(tetrahydrogen triphosphate) | thymidine 5'-triphosphate |
Type | Small organic molecule |
Emp. Form. | C10H17N2O14P3 |
Mol. Mass. | 482.1683 |
SMILES | Cc1cn([C@H]2C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O2)c(=O)[nH]c1=O |r| |
Structure |
|