Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50483107 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_685646 (CHEMBL1285548) |
---|
Ki | 0.236000±n/a nM |
---|
Citation | Ali, A; Reddy, GS; Nalam, MN; Anjum, SG; Cao, H; Schiffer, CA; Rana, TM Structure-based design, synthesis, and structure-activity relationship studies of HIV-1 protease inhibitors incorporating phenyloxazolidinones. J Med Chem53:7699-708 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50483107 |
---|
n/a |
---|
Name | BDBM50483107 |
Synonyms: | CHEMBL1276084 |
Type | Small organic molecule |
Emp. Form. | C33H39N3O8S |
Mol. Mass. | 637.743 |
SMILES | CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@@H]1CN(C(=O)O1)c1cccc(c1)C(C)=O)S(=O)(=O)c1ccc(CO)cc1 |r| |
Structure |
|