| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50483621 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_741066 (CHEMBL1764294) |
|---|
| IC50 | 2000±n/a nM |
|---|
| Citation |  Makatini, MM; Petzold, K; Sriharsha, SN; Soliman, ME; Honarparvar, B; Arvidsson, PI; Sayed, Y; Govender, P; Maguire, GE; Kruger, HG; Govender, T Pentacycloundecane-based inhibitors of wild-type C-South African HIV-protease. Bioorg Med Chem Lett21:2274-7 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50483621 |
|---|
| n/a |
|---|
| Name | BDBM50483621 |
|---|
| Synonyms: | CHEMBL1761679 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H46N6O9 |
|---|
| Mol. Mass. | 646.7317 |
|---|
| SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](N)CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NC12NC(=O)C3(O)C4C5C(C14)C1CC5C3C21 |r,THB:37:38:45.44:42,40:39:45.44:42| |
|---|
| Structure | 
|
|---|
Search and Browse
