Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50483627 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_741066 (CHEMBL1764294) |
---|
IC50 | 500±n/a nM |
---|
Citation | Makatini, MM; Petzold, K; Sriharsha, SN; Soliman, ME; Honarparvar, B; Arvidsson, PI; Sayed, Y; Govender, P; Maguire, GE; Kruger, HG; Govender, T Pentacycloundecane-based inhibitors of wild-type C-South African HIV-protease. Bioorg Med Chem Lett21:2274-7 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50483627 |
---|
n/a |
---|
Name | BDBM50483627 |
Synonyms: | CHEMBL1761678 |
Type | Small organic molecule |
Emp. Form. | C26H37N5O7 |
Mol. Mass. | 531.6013 |
SMILES | CC[C@H](C)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NC12NC(=O)C3(O)C4C5C(C14)C1CC5C3C21 |r,THB:29:30:37.36:34,32:31:37.36:34| |
Structure |
|