Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50484192 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_763964 (CHEMBL1820047) |
---|
Ki | 13±n/a nM |
---|
Citation | Ghosh, AK; Chapsal, BD; Parham, GL; Steffey, M; Agniswamy, J; Wang, YF; Amano, M; Weber, IT; Mitsuya, H Design of HIV-1 protease inhibitors with C3-substituted hexahydrocyclopentafuranyl urethanes as P2-ligands: synthesis, biological evaluation, and protein-ligand X-ray crystal structure. J Med Chem54:5890-901 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50484192 |
---|
n/a |
---|
Name | BDBM50484192 |
Synonyms: | CHEMBL1819298 |
Type | Small organic molecule |
Emp. Form. | C31H45N3O7S |
Mol. Mass. | 603.77 |
SMILES | [H][C@@]12C[C@@H](C[C@]1([H])[C@@H](CO2)N(C)C)OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc(OC)cc1 |r| |
Structure |
|