Reaction Details |
| Report a problem with these data |
Target | HIV-1 protease |
---|
Ligand | BDBM50483621 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_768437 (CHEMBL1832156) |
---|
IC50 | 2000±n/a nM |
---|
Citation | Makatini, MM; Petzold, K; Sriharsha, SN; Ndlovu, N; Soliman, ME; Honarparvar, B; Parboosing, R; Naidoo, A; Arvidsson, PI; Sayed, Y; Govender, P; Maguire, GE; Kruger, HG; Govender, T Synthesis and structural studies of pentacycloundecane-based HIV-1 PR inhibitors: a hybrid 2D NMR and docking/QM/MM/MD approach. Eur J Med Chem46:3976-85 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
HIV-1 protease |
---|
Name: | HIV-1 protease |
Synonyms: | HIV-1 | HIV-1 protease | protease |
Type: | PROTEIN |
Mol. Mass.: | 10795.19 |
Organism: | Human immunodeficiency virus |
Description: | ChEMBL_118439 |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50483621 |
---|
n/a |
---|
Name | BDBM50483621 |
Synonyms: | CHEMBL1761679 |
Type | Small organic molecule |
Emp. Form. | C31H46N6O9 |
Mol. Mass. | 646.7317 |
SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](N)CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NC12NC(=O)C3(O)C4C5C(C14)C1CC5C3C21 |r,THB:37:38:45.44:42,40:39:45.44:42| |
Structure |
|