| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HIV-1 protease |
|---|
| Ligand | BDBM50483625 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_768437 (CHEMBL1832156) |
|---|
| IC50 | 5000±n/a nM |
|---|
| Citation |  Makatini, MM; Petzold, K; Sriharsha, SN; Ndlovu, N; Soliman, ME; Honarparvar, B; Parboosing, R; Naidoo, A; Arvidsson, PI; Sayed, Y; Govender, P; Maguire, GE; Kruger, HG; Govender, T Synthesis and structural studies of pentacycloundecane-based HIV-1 PR inhibitors: a hybrid 2D NMR and docking/QM/MM/MD approach. Eur J Med Chem46:3976-85 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HIV-1 protease |
|---|
| Name: | HIV-1 protease |
|---|
| Synonyms: | HIV-1 | HIV-1 protease | protease |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 10795.19 |
|---|
| Organism: | Human immunodeficiency virus |
|---|
| Description: | ChEMBL_118439 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50483625 |
|---|
| n/a |
|---|
| Name | BDBM50483625 |
|---|
| Synonyms: | CHEMBL1761680 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H43N7O8 |
|---|
| Mol. Mass. | 617.6938 |
|---|
| SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](N)CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)NC12NC(=O)C3(O)C4C5C(C14)C1CC5C3C21 |r,THB:35:36:43.42:40,38:37:43.42:40| |
|---|
| Structure | 
|
|---|
Search and Browse
