Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Metallo-beta-lactamase type 2 |
---|
Ligand | BDBM50484376 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_775599 (CHEMBL1913283) |
---|
Ki | 29000±n/a nM |
---|
Citation | Mohamed, MS; Hussein, WM; McGeary, RP; Vella, P; Schenk, G; Abd El-Hameed, RH Synthesis and kinetic testing of new inhibitors for a metallo-?-lactamase from Klebsiella pneumonia and Pseudomonas aeruginosa. Eur J Med Chem46:6075-82 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Metallo-beta-lactamase type 2 |
---|
Name: | Metallo-beta-lactamase type 2 |
Synonyms: | B2 metallo-beta-lactamase | BLA-IMP | BLAB_SERMA | Beta-lactamase type II | IMP-1 | Metallo-beta-lactamase type II |
Type: | undefined |
Mol. Mass.: | 27125.88 |
Organism: | Serratia marcescens |
Description: | P52699 |
Residue: | 246 |
Sequence: | MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNA
EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELT
NELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKP
YGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK
PSKPSN
|
|
|
BDBM50484376 |
---|
n/a |
---|
Name | BDBM50484376 |
Synonyms: | CHEMBL1910739 |
Type | Small organic molecule |
Emp. Form. | C28H19N5O |
Mol. Mass. | 441.4834 |
SMILES | [#6]-[#8]-c1ccc(cc1)-n1c2-[#7]=[#6]-[#7]\[#6](=[#6](\C#N)C#N)-c2c(c1-c1ccccc1)-c1ccccc1 |c:11| |
Structure |
|