| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50484841 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_807142 (CHEMBL1959806) |
|---|
| Ki | 0.0075±n/a nM |
|---|
| Citation |  Ghosh, AK; Chapsal, BD; Steffey, M; Agniswamy, J; Wang, YF; Amano, M; Weber, IT; Mitsuya, H Substituent effects on P2-cyclopentyltetrahydrofuranyl urethanes: design, synthesis, and X-ray studies of potent HIV-1 protease inhibitors. Bioorg Med Chem Lett22:2308-11 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50484841 |
|---|
| n/a |
|---|
| Name | BDBM50484841 |
|---|
| Synonyms: | CHEMBL1958481 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H43N3O8S |
|---|
| Mol. Mass. | 617.753 |
|---|
| SMILES | [H][C@@]12C[C@@H](C[C@]1([H])[C@H](CO2)NC(C)=O)OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc(OC)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
