| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50485188 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_821526 (CHEMBL2038194) |
|---|
| IC50 | 1010±n/a nM |
|---|
| Citation |  Pawar, SA; Jabgunde, AM; Govender, P; Maguire, GE; Kruger, HG; Parboosing, R; Soliman, ME; Sayed, Y; Dhavale, DD; Govender, T Synthesis and molecular modelling studies of novel carbapeptide analogs for inhibition of HIV-1 protease. Eur J Med Chem53:13-21 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50485188 |
|---|
| n/a |
|---|
| Name | BDBM50485188 |
|---|
| Synonyms: | CHEMBL2035866 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H31N3O8 |
|---|
| Mol. Mass. | 417.454 |
|---|
| SMILES | [H][C@]12OC([C@@H](N)CC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O)[C@H](O)[C@@]1([H])OC(C)(C)O2 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
