| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50032424 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_202059 (CHEMBL813142) |
|---|
| Ki | 597±n/a nM |
|---|
| Citation |  Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI Synthesis and sigma binding properties of 1'- and 3'-halo- and 1',3'-dihalo-N-normetazocine analogues. J Med Chem38:2986-9 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50032424 |
|---|
| n/a |
|---|
| Name | BDBM50032424 |
|---|
| Synonyms: | 3-Benzyl-9-iodo-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol | CHEMBL103707 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H24INO |
|---|
| Mol. Mass. | 433.3258 |
|---|
| SMILES | CC1C2Cc3cc(I)c(O)cc3C1(C)CCN2Cc1ccccc1 |TLB:10:11:1:16.14.15,17:16:1:11.4.3| |
|---|
| Structure | 
|
|---|
Search and Browse
