| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50033546 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_55140 (CHEMBL668783) |
|---|
| IC50 | 34±n/a nM |
|---|
| Citation |  Gangjee, A; Zaveri, N; Kothare, M; Queener, SF Nonclassical 2,4-diamino-6-(aminomethyl)-5,6,7,8-tetrahydroquinazoline antifolates: synthesis and biological activities. J Med Chem38:3660-8 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21638.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | n/a |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
|---|
| BDBM50033546 |
|---|
| n/a |
|---|
| Name | BDBM50033546 |
|---|
| Synonyms: | 6-{[(3,4-Dichloro-phenyl)-methyl-amino]-methyl}-5,6,7,8-tetrahydro-quinazoline-2,4-diamine | CHEMBL121433 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H19Cl2N5 |
|---|
| Mol. Mass. | 352.262 |
|---|
| SMILES | CN(CC1CCc2nc(N)nc(N)c2C1)c1ccc(Cl)c(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
