Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50033858 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_201264 (CHEMBL804882) |
---|
IC50 | 64.1±n/a nM |
---|
Citation | Perrone, R; Berardi, F; Colabufo, NA; Leopoldo, M; Tortorella, V; Fiorentini, F; Olgiati, V; Ghiglieri, A; Govoni, S High affinity and selectivity on 5-HT1A receptor of 1-aryl-4-[1-tetralin)alkyl]piperazines. 2. J Med Chem38:942-9 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50033858 |
---|
n/a |
---|
Name | BDBM50033858 |
Synonyms: | 1-(2-Methoxy-phenyl)-4-[3-(7-methoxy-1,2,3,4-tetrahydro-naphthalen-1-yl)-propyl]-piperazine | CHEMBL424125 |
Type | Small organic molecule |
Emp. Form. | C25H34N2O2 |
Mol. Mass. | 394.5497 |
SMILES | COc1ccc2CCCC(CCCN3CCN(CC3)c3ccccc3OC)c2c1 |
Structure |
|