| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HIV-1 protease |
|---|
| Ligand | BDBM50489369 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_937804 (CHEMBL2318301) |
|---|
| Ki | 8.9±n/a nM |
|---|
| Citation |  Zhang, H; Wang, YF; Shen, CH; Agniswamy, J; Rao, KV; Xu, CX; Ghosh, AK; Harrison, RW; Weber, IT Novel P2 tris-tetrahydrofuran group in antiviral compound 1 (GRL-0519) fills the S2 binding pocket of selected mutants of HIV-1 protease. J Med Chem56:1074-83 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HIV-1 protease |
|---|
| Name: | HIV-1 protease |
|---|
| Synonyms: | HIV-1 | HIV-1 protease | protease |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 10795.19 |
|---|
| Organism: | Human immunodeficiency virus |
|---|
| Description: | ChEMBL_118439 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50489369 |
|---|
| n/a |
|---|
| Name | BDBM50489369 |
|---|
| Synonyms: | CHEMBL1232930 | GRL-0519 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H40N2O9S |
|---|
| Mol. Mass. | 604.712 |
|---|
| SMILES | [H][C@@]12OCC[C@]1([H])[C@@]1([H])[C@H](CO[C@@]1([H])O2)OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc(OC)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
