Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50034942 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_52967 (CHEMBL664175) |
---|
IC50 | 50±n/a nM |
---|
Citation | Gangjee, A; Vasudevan, A; Queener, SF; Kisliuk, RL 6-substituted 2,4-diamino-5-methylpyrido[2,3-d]pyrimidines as inhibitors of dihydrofolate reductases from Pneumocystis carinii and Toxoplasma gondii and as antitumor agents. J Med Chem38:1778-85 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_PNECA | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 23891.29 |
Organism: | Pneumocystis carinii |
Description: | n/a |
Residue: | 206 |
Sequence: | MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRK
TWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRI
FVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESW
VGTKVPHGKINEDGFDYEFEMWTRDL
|
|
|
BDBM50034942 |
---|
n/a |
---|
Name | BDBM50034942 |
Synonyms: | 6-{[Ethyl-(3,4,5-trimethoxy-phenyl)-amino]-methyl}-5-methyl-pyrido[2,3-d]pyrimidine-2,4-diamine | CHEMBL52433 |
Type | Small organic molecule |
Emp. Form. | C20H26N6O3 |
Mol. Mass. | 398.4588 |
SMILES | CCN(Cc1cnc2nc(N)nc(N)c2c1C)c1cc(OC)c(OC)c(OC)c1 |
Structure |
|