Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50034938 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54967 (CHEMBL875140) |
---|
IC50 | 128±n/a nM |
---|
Citation | Gangjee, A; Vasudevan, A; Queener, SF; Kisliuk, RL 6-substituted 2,4-diamino-5-methylpyrido[2,3-d]pyrimidines as inhibitors of dihydrofolate reductases from Pneumocystis carinii and Toxoplasma gondii and as antitumor agents. J Med Chem38:1778-85 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 21638.84 |
Organism: | Rattus norvegicus (rat) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50034938 |
---|
n/a |
---|
Name | BDBM50034938 |
Synonyms: | 6-[(2,5-Dimethoxy-phenylamino)-methyl]-5-methyl-pyrido[2,3-d]pyrimidine-2,4-diamine | CHEMBL23021 |
Type | Small organic molecule |
Emp. Form. | C17H20N6O2 |
Mol. Mass. | 340.3797 |
SMILES | COc1ccc(OC)c(NCc2cnc3nc(N)nc(N)c3c2C)c1 |
Structure |
|