| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50037137 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_138749 (CHEMBL747922) |
|---|
| Ki | 29±n/a nM |
|---|
| Citation |  Cheng, CY; Hsin, LW; Tsai, MC; Schmidt, WK; Smith, C; Tam, SW Synthesis and opioid activity of 7-oxygenated 2,3,4,4a,5,6,7,7a-octahydro-1H-benzofuro[3,2-e]isoquinolin-9-ols. J Med Chem37:3121-7 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50037137 |
|---|
| n/a |
|---|
| Name | BDBM50037137 |
|---|
| Synonyms: | (4aR,7S,7aR,12bS)-3-Cyclopropylmethyl-9-methoxy-2,3,4,4a,5,6,7,7a-octahydro-1H-8-oxa-3-aza-benzo[d]fluoren-7-ol | CHEMBL106085 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H27NO3 |
|---|
| Mol. Mass. | 329.4333 |
|---|
| SMILES | COc1cccc2c1O[C@H]1[C@@H](O)CC[C@H]3CN(CC4CC4)CC[C@]213 |
|---|
| Structure | 
|
|---|
Search and Browse
