| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50493301 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_981456 (CHEMBL2428634) |
|---|
| Ki | 0.021000±n/a nM |
|---|
| Citation |  Ghosh, AK; Parham, GL; Martyr, CD; Nyalapatla, PR; Osswald, HL; Agniswamy, J; Wang, YF; Amano, M; Weber, IT; Mitsuya, H Highly potent HIV-1 protease inhibitors with novel tricyclic P2 ligands: design, synthesis, and protein-ligand X-ray studies. J Med Chem56:6792-802 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50493301 |
|---|
| n/a |
|---|
| Name | BDBM50493301 |
|---|
| Synonyms: | CHEMBL2426458 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H42N2O9S |
|---|
| Mol. Mass. | 618.738 |
|---|
| SMILES | [H][C@@]12COC[C@H](OC(=O)N[C@@H](Cc3ccccc3)[C@H](O)CN(CC(C)C)S(=O)(=O)c3ccc(OC)cc3)[C@]1([H])[C@@]1([H])CCO[C@@]1([H])O2 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
