Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50494409 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1276057 (CHEMBL3088980) |
---|
Ki | 5.0±n/a nM |
---|
Citation | Joshi, A; Véron, JB; Unge, J; Rosenquist, Ĺ; Wallberg, H; Samuelsson, B; Hallberg, A; Larhed, M Design and synthesis of P1-P3 macrocyclic tertiary-alcohol-comprising HIV-1 protease inhibitors. J Med Chem56:8999-9007 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50494409 |
---|
n/a |
---|
Name | BDBM50494409 |
Synonyms: | CHEMBL3086262 |
Type | Small organic molecule |
Emp. Form. | C36H50BrN5O6 |
Mol. Mass. | 728.716 |
SMILES | COC(=O)N[C@H](C(=O)NN(CCC[C@@]1(O)Cc2ccc(cc2)\C=C/CNC(=O)[C@@H](NC1=O)C(C)(C)C)Cc1ccc(Br)cc1)C(C)(C)C |r,c:23| |
Structure |
|