| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50494411 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1276057 (CHEMBL3088980) |
|---|
| Ki | 15±n/a nM |
|---|
| Citation |  Joshi, A; Véron, JB; Unge, J; Rosenquist, Ĺ; Wallberg, H; Samuelsson, B; Hallberg, A; Larhed, M Design and synthesis of P1-P3 macrocyclic tertiary-alcohol-comprising HIV-1 protease inhibitors. J Med Chem56:8999-9007 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50494411 |
|---|
| n/a |
|---|
| Name | BDBM50494411 |
|---|
| Synonyms: | CHEMBL3086254 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H52BrN5O6 |
|---|
| Mol. Mass. | 742.743 |
|---|
| SMILES | COC(=O)N[C@H](C(=O)NN(CCC[C@@](O)(Cc1ccc(C=C)cc1)C(=O)N[C@@H](C(C)C)C(=O)NCC=C)Cc1ccc(Br)cc1)C(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
