Reaction Details |
| Report a problem with these data |
Target | Aldo-keto reductase family 1 member B1 |
---|
Ligand | BDBM50495484 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1287395 (CHEMBL3111377) |
---|
IC50 | 9000±n/a nM |
---|
Citation | Li, L; Chang, KC; Zhou, Y; Shieh, B; Ponder, J; Abraham, AD; Ali, H; Snow, A; Petrash, JM; LaBarbera, DV Design of an amide N-glycoside derivative of ?-glucogallin: a stable, potent, and specific inhibitor of aldose reductase. J Med Chem57:71-7 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Aldo-keto reductase family 1 member B1 |
---|
Name: | Aldo-keto reductase family 1 member B1 |
Synonyms: | AKR1B1 | ALDR1 | ALDR_HUMAN | ALR2 | AR | Aldo-keto reductase family 1 member B1 (AKR1B1) | Aldose Reductase (ALR2) | Aldose reductase | Aldose reductase (AR) |
Type: | Protein |
Mol. Mass.: | 35855.50 |
Organism: | Homo sapiens (Human) |
Description: | P15121. 4LAU; 2IKI; 4LB4; 2FZD; 2FZ8; 1US0 |
Residue: | 316 |
Sequence: | MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
|
|
|
BDBM50495484 |
---|
n/a |
---|
Name | BDBM50495484 |
Synonyms: | CHEMBL3109109 |
Type | Small organic molecule |
Emp. Form. | C13H17NO9 |
Mol. Mass. | 331.2754 |
SMILES | OC[C@H]1O[C@@H](NC(=O)c2cc(O)c(O)c(O)c2)[C@H](O)[C@@H](O)[C@@H]1O |r| |
Structure |
|