| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50495686 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1290254 (CHEMBL3118383) |
|---|
| Ki | 257000±n/a nM |
|---|
| Citation |  Gros, G; Martinez, L; Gimenez, AS; Adler, P; Maurin, P; Wolkowicz, R; Falson, P; Hasserodt, J Modular construction of quaternary hemiaminal-based inhibitor candidates and their in cellulo assessment with HIV-1 protease. Bioorg Med Chem21:5407-13 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50495686 |
|---|
| n/a |
|---|
| Name | BDBM50495686 |
|---|
| Synonyms: | CHEMBL3115090 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H27N3O2 |
|---|
| Mol. Mass. | 365.4687 |
|---|
| SMILES | O=C[C@H](Cc1ccccc1)NC(=O)N(Cc1ccccc1)N1CCCCC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
