| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein Tat |
|---|
| Ligand | BDBM50045402 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_209908 (CHEMBL811912) |
|---|
| IC50 | 14300±n/a nM |
|---|
| Citation |  Michne, WF; Schroeder, JD; Bailey, TR; Young, DC; Hughes, JV; Dutko, FJ Keto/enol epoxy steroids: a new structural class of HIV-1 Tat inhibitors. J Med Chem36:2701-2 (1993) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein Tat |
|---|
| Name: | Protein Tat |
|---|
| Synonyms: | Human immunodeficiency virus type 1 Tat protein | Protein Tat | TAT_HV112 | Transactivating regulatory protein | tat |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 9771.75 |
|---|
| Organism: | Human immunodeficiency virus type 1 (isolate PCV12 group M subtype B)(HIV-1) |
|---|
| Description: | ChEMBL_199318 |
|---|
| Residue: | 86 |
|---|
| Sequence: | MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAPQ
GSQTHQVSLSKQPTSQSRGDPTGPKE
|
|
|
|---|
| BDBM50045402 |
|---|
| n/a |
|---|
| Name | BDBM50045402 |
|---|
| Synonyms: | 3,17-Dihydroxy-10,13-dimethyl-1,4,6,7,8,9,10,11,12,13,14,15,16,17-tetradecahydro-20-oxa-cyclopropa[4,5]cyclopenta[a]phenanthrene-2-carboxylic acid amide | CHEMBL92554 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H29NO4 |
|---|
| Mol. Mass. | 347.4486 |
|---|
| SMILES | C[C@]12CCC3C(CC[C@]45OC4C(=O)C(C[C@]35C)C(N)=O)C1CC[C@@H]2O |
|---|
| Structure | 
|
|---|
Search and Browse
