| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Methionine aminopeptidase |
|---|
| Ligand | BDBM50497530 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1437716 (CHEMBL3382363) |
|---|
| IC50 | 2800±n/a nM |
|---|
| Citation |  Altmeyer, M; Amtmann, E; Heyl, C; Marschner, A; Scheidig, AJ; Klein, CD Beta-aminoketones as prodrugs for selective irreversible inhibitors of type-1 methionine aminopeptidases. Bioorg Med Chem Lett24:5310-4 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Methionine aminopeptidase |
|---|
| Name: | Methionine aminopeptidase |
|---|
| Synonyms: | EcMetAP | MAP1_ECOLI | Methionine Aminopeptidase (MAP) | Methionine aminopeptidase | Peptidase M | map |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 29326.96 |
|---|
| Organism: | Escherichia coli (strain K12) |
|---|
| Description: | Full-length untagged EcMAP was expressed in E. coli. |
|---|
| Residue: | 264 |
|---|
| Sequence: | MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACL
GYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTI
MGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEE
PQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVV
TDNGCEILTLRKDDTIPAIISHDE
|
|
|
|---|
| BDBM50497530 |
|---|
| n/a |
|---|
| Name | BDBM50497530 |
|---|
| Synonyms: | CHEMBL3337638 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H16ClNO |
|---|
| Mol. Mass. | 225.715 |
|---|
| SMILES | Cl.CN(C)CC1Cc2ccccc2C1=O |
|---|
| Structure | 
|
|---|
Search and Browse
