| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50498230 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1496710 (CHEMBL3579413) |
|---|
| Ki | 0.003±n/a nM |
|---|
| Citation |  Agniswamy, J; Louis, JM; Shen, CH; Yashchuk, S; Ghosh, AK; Weber, IT Substituted Bis-THF Protease Inhibitors with Improved Potency against Highly Resistant Mature HIV-1 Protease PR20. J Med Chem58:5088-95 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50498230 |
|---|
| n/a |
|---|
| Name | BDBM50498230 |
|---|
| Synonyms: | CHEMBL3577576 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H40N2O9S |
|---|
| Mol. Mass. | 592.701 |
|---|
| SMILES | [H][C@]12OC[C@H](OC)[C@@]1([H])[C@H](CO2)OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc(OC)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
