| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E synthase |
|---|
| Ligand | BDBM50500808 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1551033 (CHEMBL3761047) |
|---|
| IC50 | 2000±n/a nM |
|---|
| Citation |  Iranshahi, M; Chini, MG; Masullo, M; Sahebkar, A; Javidnia, A; Chitsazian Yazdi, M; Pergola, C; Koeberle, A; Werz, O; Pizza, C; Terracciano, S; Piacente, S; Bifulco, G Can Small Chemical Modifications of Natural Pan-inhibitors Modulate the Biological Selectivity? The Case of Curcumin Prenylated Derivatives Acting as HDAC or mPGES-1 Inhibitors. J Nat Prod78:2867-79 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E synthase |
|---|
| Name: | Prostaglandin E synthase |
|---|
| Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17112.22 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 152 |
|---|
| Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
|---|
| BDBM50500808 |
|---|
| n/a |
|---|
| Name | BDBM50500808 |
|---|
| Synonyms: | CHEMBL3758528 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C36H44O6 |
|---|
| Mol. Mass. | 572.731 |
|---|
| SMILES | [#6]-[#8]-c1cc(\[#6]=[#6]\[#6](=O)-[#6](-[#6]\[#6]=[#6](\[#6])-[#6])-[#6](=O)\[#6]=[#6]\c2ccc(-[#8]-[#6]\[#6]=[#6](\[#6])-[#6])c(-[#8]-[#6])c2)ccc1-[#8]-[#6]\[#6]=[#6](\[#6])-[#6] |
|---|
| Structure | 
|
|---|
Search and Browse
