| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM22040 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_39280 (CHEMBL650541) |
|---|
| IC50 | 10±n/a nM |
|---|
| Citation |  TenBrink, RE; Bergh, CL; Duncan, JN; Harris, DW; Huff, RM; Lahti, RA; Lawson, CF; Lutzke, BS; Martin, IJ; Rees, SA; Schlachter, SK; Sih, JC; Smith, MW (S)-(-)-4-[4-[2-(isochroman-1-yl)ethyl]-piperazin-1-yl] benzenesulfonamide, a selective dopamine D4 antagonist. J Med Chem39:2435-7 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral-type benzodiazepine receptor | TSPO_MOUSE | Tspo |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18845.65 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_39280 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE
|
|
|
|---|
| BDBM22040 |
|---|
| n/a |
|---|
| Name | BDBM22040 |
|---|
| Synonyms: | 4 -chlorodiazepam | 4' Cl-diazepam | 7-chloro-5-(4-chlorophenyl)-1-methyl-1,3-dihydro-2H-1,4-benzodiazepin-2-one | 7-chloro-5-(4-chlorophenyl)-1-methyl-2,3-dihydro-1H-1,4-benzodiazepin-2-one | CHEMBL286346 | Ro 5-4864 | Ro-05-4864 | Ro-4864 | Ro5-4864 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H12Cl2N2O |
|---|
| Mol. Mass. | 319.185 |
|---|
| SMILES | CN1c2ccc(Cl)cc2C(=NCC1=O)c1ccc(Cl)cc1 |c:10| |
|---|
| Structure | 
|
|---|
Search and Browse
