| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma intracellular receptor 2 |
|---|
| Ligand | BDBM50502554 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1807839 (CHEMBL4307198) |
|---|
| Ki | 32±n/a nM |
|---|
| Citation |  Zampieri, D; Fortuna, S; Calabretti, A; Romano, M; Menegazzi, R; Schepmann, D; Wünsch, B; Collina, S; Zanon, D; Mamolo, MG Discovery of new potent dual sigma receptor/GluN2b ligands with antioxidant property as neuroprotective agents. Eur J Med Chem180:268-282 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma intracellular receptor 2 |
|---|
| Name: | Sigma intracellular receptor 2 |
|---|
| Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20953.88 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q5U3Y7 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
|---|
| BDBM50502554 |
|---|
| n/a |
|---|
| Name | BDBM50502554 |
|---|
| Synonyms: | CHEMBL4533030 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H30N2O |
|---|
| Mol. Mass. | 350.4971 |
|---|
| SMILES | CN(CCCCN1C(=O)CCc2ccccc12)Cc1ccc(C)cc1C |
|---|
| Structure | 
|
|---|
Search and Browse
