Reaction Details |
| Report a problem with these data |
Target | Tumor necrosis factor |
---|
Ligand | BDBM50052601 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_212401 (CHEMBL815988) |
---|
IC50 | 120000±n/a nM |
---|
Citation | Muller, GW; Corral, LG; Shire, MG; Wang, H; Moreira, A; Kaplan, G; Stirling, DI Structural modifications of thalidomide produce analogs with enhanced tumor necrosis factor inhibitory activity. J Med Chem39:3238-40 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tumor necrosis factor |
---|
Name: | Tumor necrosis factor |
Synonyms: | Cachectin | TNF | TNF-a | TNF-alpha | TNFA | TNFA_HUMAN | TNFSF2 | Tumor necrosis factor (TNF-alpha) | Tumor necrosis factor (TNFa) | Tumor necrosis factor alpha (TNFα) | Tumor necrosis factor ligand superfamily member 2 | Tumor necrosis factor, membrane form | Tumor necrosis factor, soluble form | tumor necrosis factor alpha |
Type: | Enzyme |
Mol. Mass.: | 25645.11 |
Organism: | Homo sapiens (Human) |
Description: | P01375 |
Residue: | 233 |
Sequence: | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
|
|
|
BDBM50052601 |
---|
n/a |
---|
Name | BDBM50052601 |
Synonyms: | 3-(1,3-Dioxo-1,3-dihydro-isoindol-2-yl)-3-(3-methoxy-phenyl)-propionamide | CHEMBL111637 |
Type | Small organic molecule |
Emp. Form. | C18H16N2O4 |
Mol. Mass. | 324.3306 |
SMILES | COc1cccc(c1)C(CC(N)=O)N1C(=O)c2ccccc2C1=O |
Structure |
|