Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 1 |
---|
Ligand | BDBM50056159 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_48699 (CHEMBL657992) |
---|
IC50 | 6000±n/a nM |
---|
Citation | Havlícek, L; Hanus, J; Veselý, J; Leclerc, S; Meijer, L; Shaw, G; Strnad, M Cytokinin-derived cyclin-dependent kinase inhibitors: synthesis and cdc2 inhibitory activity of olomoucine and related compounds. J Med Chem40:408-12 (1997) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 1 |
---|
Name: | Cyclin-dependent kinase 1 |
Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
Type: | Enzyme Subunit |
Mol. Mass.: | 34101.08 |
Organism: | Homo sapiens (Human) |
Description: | P06493 |
Residue: | 297 |
Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
BDBM50056159 |
---|
n/a |
---|
Name | BDBM50056159 |
Synonyms: | 2-[6-(Cyclohexyl-methyl-amino)-9-methyl-9H-purin-2-ylamino]-ethanol | CHEMBL129977 |
Type | Small organic molecule |
Emp. Form. | C15H24N6O |
Mol. Mass. | 304.3907 |
SMILES | CN(C1CCCCC1)c1nc(NCCO)nc2n(C)cnc12 |
Structure |
|