Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50034938 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54972 (CHEMBL666701) |
---|
IC50 | 130±n/a nM |
---|
Citation | Gangjee, A; Vasudevan, A; Queener, SF Synthesis and biological evaluation of nonclassical 2,4-diamino-5-methylpyrido[2,3-d]pyrimidines with novel side chain substituents as potential inhibitors of dihydrofolate reductases. J Med Chem40:479-85 (1997) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 21638.84 |
Organism: | Rattus norvegicus (rat) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50034938 |
---|
n/a |
---|
Name | BDBM50034938 |
Synonyms: | 6-[(2,5-Dimethoxy-phenylamino)-methyl]-5-methyl-pyrido[2,3-d]pyrimidine-2,4-diamine | CHEMBL23021 |
Type | Small organic molecule |
Emp. Form. | C17H20N6O2 |
Mol. Mass. | 340.3797 |
SMILES | COc1ccc(OC)c(NCc2cnc3nc(N)nc(N)c3c2C)c1 |
Structure |
|